SMART: Pfam domain Upf2

The domain within your query sequence starts at position 304 and ends at position 469; the E-value for the Upf2 domain shown below is 3.1e-44.

SEVNEPEEEGSEEEEEGEEEEEENTDYLTDSNKENETDEENAEVMIKGGGLKHVPCVEDE
DFIQALDKMMLENLQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGETESADTMPFV
MLTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLD

Upf2

PFAM accession number:	PF04050
Interpro abstract (IPR007193):	This entry represents the C-terminal domain found in Up-frameshift suppressor 2 (also known as Nonsense-mediated mRNA decay protein 2). Transcripts harbouring premature signals for translation termination are recognised and rapidly degraded by eukaryotic cells through a pathway known as nonsense-mediated mRNA decay. In Saccharomyces cerevisiae, three trans-acting factors (Upf1 to Upf3) are required for nonsense-mediated mRNA decay [ (PUBMED:11073994) ].

PFAM accession number:

PF04050

Interpro abstract (IPR007193):

This entry represents the C-terminal domain found in Up-frameshift suppressor 2 (also known as Nonsense-mediated mRNA decay protein 2). Transcripts harbouring premature signals for translation termination are recognised and rapidly degraded by eukaryotic cells through a pathway known as nonsense-mediated mRNA decay. In Saccharomyces cerevisiae, three trans-acting factors (Upf1 to Upf3) are required for nonsense-mediated mRNA decay [ (PUBMED:11073994) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Upf2