The domain within your query sequence starts at position 344 and ends at position 628; the E-value for the Uso1_p115_head domain shown below is 5.7e-72.

CQVNQDYFASVNAPSNPPRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNEKGQGEI
VATLLPSTIDATGNSVSAGQLLCGGLFSTDSLSNWCAAVALAHALQGNATQKEQLLRVQL
ATSIGNPPVSLLQQCTNILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLT
GQIAENLGEEEQLVQGLCALLLGISIYFNDNSLENYTKEKLKQLIEKRIGKENFIEKLGF
ISKHELYSRASQKPQPNFPSPEYMIFDHEFTKLVKELEGVITKAI

Uso1_p115_head

 Uso1_p115_head
PFAM accession number:PF04869
Interpro abstract (IPR006953):

This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associated protein (TAP) or Vesicle docking protein, this myosin-shaped molecule consists of an N-terminal globular head region, a coiled-coil tail which mediates dimerisation, and a short C-terminal acidic region [ (PUBMED:11927603) ]. p115 tethers COP1 vesicles to the Golgi by binding the coiled coil proteins giantin (on the vesicles) and GM130 (on the Golgi), via its C-terminal acidic region. It is required for intercisternal transport in the Golgi stack. This domain is found in the head region. The head region is highly conserved, but its function is unknown. It does not seem to be essential for vesicle tethering [ (PUBMED:11927603) ]. The N-terminal part of the head region contains context-detected Armadillo/beta-catenin-like repeats.

GO process:vesicle fusion with Golgi apparatus (GO:0048280), intracellular protein transport (GO:0006886)
GO component:Golgi membrane (GO:0000139), cytoplasm (GO:0005737)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Uso1_p115_head