The domain within your query sequence starts at position 12 and ends at position 90; the E-value for the V-SNARE domain shown below is 7.3e-29.
FAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEARELLEQMDLEVREIPPQSRGMYS NRMRSYKQEMGKLETDFKR
V-SNARE |
 |
|---|
| PFAM accession number: | PF05008 |
|---|---|
| Interpro abstract (IPR007705): | V-SNARE proteins are required for protein traffic between eukaryotic organelles. The v-SNAREs on transport vesicles interact with t-SNAREs on target membranes in order to facilitate this [ (PUBMED:10359592) ]. This domain is the N-terminal half of the V-Snare proteins. |
| GO process: | intracellular protein transport (GO:0006886) |
| GO component: | membrane (GO:0016020) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-SNARE