The domain within your query sequence starts at position 1 and ends at position 41; the E-value for the V-set_CD47 domain shown below is 1.8e-15.

MFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLING

V-set_CD47

• PFAM accession number: PF08204
• Interpro abstract (IPR013270):

  This family represents the CD47 leukocyte antigen V-set like Ig domain [ (PUBMED:12124426) (PUBMED:8794870) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-set_CD47