The domain within your query sequence starts at position 336 and ends at position 372; the E-value for the VASP_tetra domain shown below is 6.3e-20.
DSDLERVKQELLEEVRKELQKMKEEIIEVFVQELRKR
VASP_tetra |
![]() |
---|
PFAM accession number: | PF08776 |
---|---|
Interpro abstract (IPR014885): | Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure [ (PUBMED:15569942) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VASP_tetra