SMART: Pfam domain VBS

The domain within your query sequence starts at position 1234 and ends at position 1358; the E-value for the VBS domain shown below is 9.6e-8.

TFQEAQSRLNEAAAGLNQAATELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAP
SQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMC
TQQAP

VBS

PFAM accession number:	PF08913
Interpro abstract (IPR015009):	Vinculin binding sites are predominantly found in talin and talin-like molecules, enabling binding of vinculin to talin, stabilising integrin-mediated cell-matrix junctions [ (PUBMED:20399778) ]. Talin, in turn, links integrins to the actin cytoskeleton. The consensus sequence for Vinculin binding sites is LxxAAxxVAxxVxxLIxxA, with a secondary structure prediction of four amphipathic helices. The hydrophobic residues that define the VBS are themselves 'masked' and are buried in the core of a series of helical bundles that make up the talin rod [ (PUBMED:16460027) ].

PFAM accession number:

PF08913

Interpro abstract (IPR015009):

Vinculin binding sites are predominantly found in talin and talin-like molecules, enabling binding of vinculin to talin, stabilising integrin-mediated cell-matrix junctions [ (PUBMED:20399778) ]. Talin, in turn, links integrins to the actin cytoskeleton. The consensus sequence for Vinculin binding sites is LxxAAxxVAxxVxxLIxxA, with a secondary structure prediction of four amphipathic helices. The hydrophobic residues that define the VBS are themselves 'masked' and are buried in the core of a series of helical bundles that make up the talin rod [ (PUBMED:16460027) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VBS