The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the VHS domain shown below is 4.2e-10.
MCVQNCGPSFQSLIVKKEFIKDTLVKLLNPRYTLPLETQNRILNFIKTWSQGFPGGVDVS EVKEVYLDLLKKG
VHS |
![]() |
---|
PFAM accession number: | PF00790 |
---|---|
Interpro abstract (IPR002014): | The VHS domain is an about 150 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM. The VHS domain is found at the N- termini of proteins associated with endocytocis and/or vesicular trafficking, often in association with other domains like FYVE, SH3 or TAM [ (PUBMED:9600884) (PUBMED:9872381) ]. The VHS domain of Hrs makes both intra- and intermolecular interactions with FYVE domains and it has been proposed that it might as well interact with other domains. The VHS domain might function as a multipurpose docking adapter that localizes proteins to the membrane through interactions with the membrane and/or the endocytic machinery [ (PUBMED:10693761) (PUBMED:10985773) ]. Resolution of the crystal structure of the VHS domain of Drosophila Hrs and human Tom1 revealed that it consists of eight helices arranged in a superhelix [ (PUBMED:10693761) (PUBMED:10985773) ]. |
GO process: | intracellular protein transport (GO:0006886) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VHS