The domain within your query sequence starts at position 862 and ends at position 908; the E-value for the VPS11_C domain shown below is 5.2e-22.

PENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFN

VPS11_C

 VPS11_C
PFAM accession number:PF12451
Interpro abstract (IPR024763):

Vps 11 is one of the evolutionarily conserved class C vacuolar protein sorting genes (c-vps: vps11, vps16, vps18, and vps33), whose products physically associate to form the c-vps protein complex required for vesicle docking and fusion. This entry represents the C-terminal domain of vps11.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS11_C