The domain within your query sequence starts at position 3539 and ends at position 3706; the E-value for the VPS13_C domain shown below is 2.6e-30.
VLPVQVTQHAKALVNAVKLRKLLIQPVNLLISIHASLKLYIASDHTPLSFSVFERGPVFT TARQLVHALAMHYAAGALFRAGWVVGSLEILGSPASLVRSIGNGISDFFRLPYEGLTRGP GAFVSGVSRGTTSFVKHISKGALTSITNLATSLARNMGRLSLDEEHYN
VPS13_C |
![]() |
---|
PFAM accession number: | PF16909 |
---|---|
Interpro abstract (IPR031645): | This entry represents the C-terminal domain of vacuolar sorting-associated 13 proteins. The exact function of this domain is not known [ (PUBMED:15498460) (PUBMED:21764909) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13_C