The domain within your query sequence starts at position 120 and ends at position 190; the E-value for the Vezatin domain shown below is 2.1e-9.
ILSAGQPQQESGHLPTLCSLATPNTWVSAACSFNKAAQHPGQHLIGLRKAVYRTVRANFQ AARLATLYMLK
Vezatin |
---|
PFAM accession number: | PF12632 |
---|---|
Interpro abstract (IPR026859): | Vezatin is a peroxisome transmembrane receptor that is involved in membrane-membrane and cell-cell adhesions. In the movement of peroxisomes, it binds to class V [ (PUBMED:16678774) ] and class VIIa [ (PUBMED:17379651) ] myosins to guide the organelle through the microtubules [ (PUBMED:16678774) ] and allow pathogens to internalise themselves into host cells [ (PUBMED:15090598) ]. In mouse cells, vezatin is crucial for spermatozoan production [ (PUBMED:17379651) ]. It interacts with the cadherin-catenin complex bridging it to the C-terminal FERM domain of myosin VIIA [ (PUBMED:11080149) ]. This entry represents a myosin-binding domain found in vezatin and inheritance of peroxisomes protein 2 (Inp2). Inp2 has been identified as the peroxisome-specific receptor for class V myosin, Myo2p [ (PUBMED:16678774) ]. |
GO function: | myosin binding (GO:0017022) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vezatin