SMART: Pfam domain Voldacs

The domain within your query sequence starts at position 40 and ends at position 168; the E-value for the Voldacs domain shown below is 1.2e-37.

GTLYIAESRLSWLDGSGLGFSLEYPTISLHAVSRDPNAYPQEHLYVMVNAKLGEESKEPL
SDEDEEDNDDVEPISEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVE
AHEQGQGDI

Voldacs

PFAM accession number:	PF03517
Interpro abstract (IPR039924):	pLCln also functions as a Sm chaperone in the stepwise snRNP assembly process [ (PUBMED:11747828) ]. snRNPs is a RNA-protein complex esessential to the removal of introns from pre-mRNA [ (PUBMED:19520849) (PUBMED:10330151) ]. In humans, the core of snRNPs is composed of seven Sm proteins bound to snRNA. pLCln tethers the hetero-oligomers SmD1/D2 and SmE/F/G into a ring-shaped 6S complex, which subsequently docks onto the SMN complex. The SMN complex then removes pICln and enables the transfer of pre-assembled Sm proteins onto snRNA [ (PUBMED:23333303) ]. Consistent with the role of human pICln, the orthologue from S. pombe is required for optimal production of the spliceosomal snRNPs and for efficient splicing [ (PUBMED:24298023) ]. ICln, known as methylosome subunit pICln or chloride conductance regulatory protein ICln, owes these different names to its function in multiple regulatory pathways [ (PUBMED:16734741) ] as different as ion permeation, ribonucleoprotein biosynthesis and cytoskeletal organisation [ (PUBMED:9556550) ]. ICln can be identified both in the cytosol and in the cellular membrane, where it functions as a chloride current regulator and is important in regulating volume decrease after cellular swelling [ (PUBMED:20573047) (PUBMED:15760659) (PUBMED:17138647) (PUBMED:19471107) ]. This entry includes ICln from animal and plants, and Lot5 from fungi. The function of Lot5 (low temperature responsive 5) is not known [ (PUBMED:11327734) ].

PFAM accession number:

PF03517

Interpro abstract (IPR039924):

pLCln also functions as a Sm chaperone in the stepwise snRNP assembly process [ (PUBMED:11747828) ]. snRNPs is a RNA-protein complex esessential to the removal of introns from pre-mRNA [ (PUBMED:19520849) (PUBMED:10330151) ]. In humans, the core of snRNPs is composed of seven Sm proteins bound to snRNA. pLCln tethers the hetero-oligomers SmD1/D2 and SmE/F/G into a ring-shaped 6S complex, which subsequently docks onto the SMN complex. The SMN complex then removes pICln and enables the transfer of pre-assembled Sm proteins onto snRNA [ (PUBMED:23333303) ]. Consistent with the role of human pICln, the orthologue from S. pombe is required for optimal production of the spliceosomal snRNPs and for efficient splicing [ (PUBMED:24298023) ].

ICln, known as methylosome subunit pICln or chloride conductance regulatory protein ICln, owes these different names to its function in multiple regulatory pathways [ (PUBMED:16734741) ] as different as ion permeation, ribonucleoprotein biosynthesis and cytoskeletal organisation [ (PUBMED:9556550) ]. ICln can be identified both in the cytosol and in the cellular membrane, where it functions as a chloride current regulator and is important in regulating volume decrease after cellular swelling [ (PUBMED:20573047) (PUBMED:15760659) (PUBMED:17138647) (PUBMED:19471107) ].

This entry includes ICln from animal and plants, and Lot5 from fungi. The function of Lot5 (low temperature responsive 5) is not known [ (PUBMED:11327734) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Voldacs