The domain within your query sequence starts at position 4 and ends at position 212; the E-value for the Vps16_N domain shown below is 3.2e-74.
YTANWNPLGDSAFYRKYELYSMDWDLKEELKDCLVAAAPYGGPIALLRNCWRKEKAASVR PVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGN EVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSANVGDLKLRRMPEVPGLQSAPSCWTTL CHDRVPHILLAVGPDLYLLDHATCSAVEK
Vps16_N |
---|
PFAM accession number: | PF04841 |
---|---|
Interpro abstract (IPR006926): | This protein forms part of the Class C vacuolar protein sorting (Vps) complex. Vps16 is essential for vacuolar protein sorting, which is essential for viability in plants, but not yeast [ (PUBMED:11702788) ]. The Class C Vps complex is required for SNARE-mediated membrane fusion at the lysosome-like yeast vacuole. It is thought to play essential roles in membrane docking and fusion at the Golgi-to-endosome and endosome-to-vacuole stages of transport [ (PUBMED:11422941) ]. The role of VPS16 in this complex is not known. |
GO process: | intracellular protein transport (GO:0006886) |
GO component: | cytoplasm (GO:0005737) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps16_N