The domain within your query sequence starts at position 374 and ends at position 434; the E-value for the Vps4_C domain shown below is 1.9e-29.
LTPCSPGDPGAIEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNADDLLKVKKFSEDF G
Vps4_C |
---|
PFAM accession number: | PF09336 |
---|---|
Interpro abstract (IPR015415): | This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerisation [ (PUBMED:16704411) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps4_C