The domain within your query sequence starts at position 573 and ends at position 707; the E-value for the Vps54 domain shown below is 7.8e-64.
EGHQYAVVGTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLKYFNSRSCQLVLGAGAL QVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITKDYHDHI AEISAKLVAIMDSLF
Vps54 |
![]() |
---|
PFAM accession number: | PF07928 |
---|---|
Interpro abstract (IPR012501): | This entry represents a domain found in vacuolar protein sorting-associated protein 54 (VPS54), which acts as component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN). VPS54 is required to tether the complex to the TGN. However, it is not involved in endocytic recycling [ (PUBMED:25799061) ]. |
GO process: | retrograde transport, endosome to Golgi (GO:0042147) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps54