The domain within your query sequence starts at position 723 and ends at position 857; the E-value for the Vps54 domain shown below is 1.6e-63.

EGHQYAVVGTVLLLIRIILEYCQCVDNIPSVTTDMLTRLTDLLKYFNSRSCQLVLGAGAL
QVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQWSMLRHFDHITKDYHDHI
AEISAKLVAIMDSLF

Vps54

Vps54
PFAM accession number:PF07928
Interpro abstract (IPR012501):

This entry represents a domain found in vacuolar protein sorting-associated protein 54 (VPS54), which acts as component of the GARP complex that is involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN). VPS54 is required to tether the complex to the TGN. However, it is not involved in endocytic recycling [ (PUBMED:25799061) ].

GO process:retrograde transport, endosome to Golgi (GO:0042147)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Vps54