The domain within your query sequence starts at position 1 and ends at position 281; the E-value for the WAPL domain shown below is 1.1e-78.
XDDSQHHQNLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMN KIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVD KVKECVDHLSRDDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIISSA KALQHCEDLIQQYNRAENSICVADSNPLPYQNVTNHVGKAVEDCMRAIIGVLLNLTNDNE WGSTKTGEQEGLIGTAMNCVLQVPKYLPQEQRFDIRVLLFL
WAPL |
![]() |
---|
PFAM accession number: | PF07814 |
---|---|
Interpro abstract (IPR022771): | This entry represents the conserved region of D. melanogaster wings apart-like protein, WAPL. It is involved in the regulation of heterochromatin structure [ (PUBMED:10747063) ]. hWAPL ( Q7Z5K2 ), the human homologue, is found to play a role in the development of cervical carcinogenesis, and is thought to have similar functions to Drosophila wapl protein [ (PUBMED:15150110) ]. Malfunction of the hWAPL pathway is thought to activate an apoptotic pathway that consequently leads to cell death [ (PUBMED:15150110) ]. The WAPL-like proteins can be found in metazoa, fungi and plants. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WAPL