SMART: Pfam domain WAPL

The domain within your query sequence starts at position 1 and ends at position 281; the E-value for the WAPL domain shown below is 1.1e-78.

XDDSQHHQNLSLCTAALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMN
KIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVD
KVKECVDHLSRDDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIISSA
KALQHCEDLIQQYNRAENSICVADSNPLPYQNVTNHVGKAVEDCMRAIIGVLLNLTNDNE
WGSTKTGEQEGLIGTAMNCVLQVPKYLPQEQRFDIRVLLFL

WAPL

PFAM accession number:	PF07814
Interpro abstract (IPR022771):	This entry represents the conserved region of D. melanogaster wings apart-like protein, WAPL. It is involved in the regulation of heterochromatin structure [ (PUBMED:10747063) ]. hWAPL ( Q7Z5K2 ), the human homologue, is found to play a role in the development of cervical carcinogenesis, and is thought to have similar functions to Drosophila wapl protein [ (PUBMED:15150110) ]. Malfunction of the hWAPL pathway is thought to activate an apoptotic pathway that consequently leads to cell death [ (PUBMED:15150110) ]. The WAPL-like proteins can be found in metazoa, fungi and plants.

PFAM accession number:

PF07814

Interpro abstract (IPR022771):

This entry represents the conserved region of D. melanogaster wings apart-like protein, WAPL. It is involved in the regulation of heterochromatin structure [ (PUBMED:10747063) ]. hWAPL ( Q7Z5K2 ), the human homologue, is found to play a role in the development of cervical carcinogenesis, and is thought to have similar functions to Drosophila wapl protein [ (PUBMED:15150110) ]. Malfunction of the hWAPL pathway is thought to activate an apoptotic pathway that consequently leads to cell death [ (PUBMED:15150110) ].

The WAPL-like proteins can be found in metazoa, fungi and plants.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WAPL