SMART: Pfam domain WASH-7

The domain within your query sequence starts at position 605 and ends at position 949; the E-value for the WASH-7_mid domain shown below is 7.9e-176.

FLYWHRAVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHSRHLESHELLLDCYDKEI
MDILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPFKVGRKDLALFFSLNPIRFFNRFID
IRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQGLDVLE
IMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVNFTYQ
FLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGITPE
GQSYLDQFRQLISQIGNAMGYIRMIRSGGLHCSSNAIRFVPDLED

WASH-7_mid

PFAM accession number:	PF14744
Interpro abstract (IPR028282):	This entry represents the central, conserved region of WASH complex subunit 7 (WASH7), also known as subunit 4 or KIAA1033 [ (PUBMED:19922875) ]. The WASH complex is present at the surface of endosomes and recruits and activates the Arp2/3 complex to induce mediated actin nucleation. The WASH complex plays a key role in the fission of tubules that serve as transport intermediates during endosome sorting [ (PUBMED:19922875) (PUBMED:20888769) ].

PFAM accession number:

PF14744

Interpro abstract (IPR028282):

This entry represents the central, conserved region of WASH complex subunit 7 (WASH7), also known as subunit 4 or KIAA1033 [ (PUBMED:19922875) ]. The WASH complex is present at the surface of endosomes and recruits and activates the Arp2/3 complex to induce mediated actin nucleation. The WASH complex plays a key role in the fission of tubules that serve as transport intermediates during endosome sorting [ (PUBMED:19922875) (PUBMED:20888769) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WASH-7_mid