The domain within your query sequence starts at position 1 and ends at position 181; the E-value for the WBS28 domain shown below is 3.8e-76.
MEAAPRVRSGLLRILLRAGRLSALLIQNRTHLYRFLLLKMAIFQHWVLGLAQEARGSGSD QARQLPEVIITCALSLALRAGLTLLWVPMWLLLWGPRLAYRVGLCCTRTVRLALGHLCVC EPLGLSPATFRDLFLSCLHSLMLVALLLLLLTWKLMQKAHHFSLGWLPSQGWGRGSNLAD L
WBS28 |
---|
PFAM accession number: | PF15164 |
---|---|
Interpro abstract (IPR029166): | Transmembrane protein 270, also known as WBS28, is an integral membrane protein. These proteins have been identified as being linked to Williams-Beuren syndrome, which is a neurodevelopmental and multisystemic disease that is characterised by mental retardation with unique cognitive and personality profile and multiple dysmorphic and metabolic features [ (PUBMED:18398435) ]. This family is found in eukaryotes and proteins are typically 266 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBS28