SMART: Pfam domain WBS28

The domain within your query sequence starts at position 1 and ends at position 264; the E-value for the WBS28 domain shown below is 1.8e-123.

MEAAPRVRSGLLRILLRAGRLSALLIQNRTHLYRFLLLKMAIFQHWVLGLAQEARGSGSD
QARQLPEVIITCALSLALRAGLTLLWVPMWLLLWGPRLAYRVGLCCTRTVRLALGHLCVC
EPLGLSPATFRDLFLSCLHSLMLVALLLLLLTWKLMQKAHHFSLGWLPSQNSVLLEAPAL
LRRLYLWVEHRTTLTSWNLAYLVTWTTCLASHLLQAAFEHTTQLAQAQEVKSQETSGPPP
QFLIPESSTTESGPLPPQPETPGE

WBS28

PFAM accession number:	PF15164
Interpro abstract (IPR029166):	Transmembrane protein 270, also known as WBS28, is an integral membrane protein. These proteins have been identified as being linked to Williams-Beuren syndrome, which is a neurodevelopmental and multisystemic disease that is characterised by mental retardation with unique cognitive and personality profile and multiple dysmorphic and metabolic features [ (PUBMED:18398435) ]. This family is found in eukaryotes and proteins are typically 266 amino acids in length.

PFAM accession number:

PF15164

Interpro abstract (IPR029166):

Transmembrane protein 270, also known as WBS28, is an integral membrane protein. These proteins have been identified as being linked to Williams-Beuren syndrome, which is a neurodevelopmental and multisystemic disease that is characterised by mental retardation with unique cognitive and personality profile and multiple dysmorphic and metabolic features [ (PUBMED:18398435) ]. This family is found in eukaryotes and proteins are typically 266 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WBS28