The domain within your query sequence starts at position 5 and ends at position 54; the E-value for the WHAMM-JMY_N domain shown below is 1.1e-30.

QPDSLDGWVPLREDLFPEPERHQLRFLVAWNAAKGQFAVTCHDRTAQRRR

WHAMM-JMY_N

• PFAM accession number: PF15920
• Interpro abstract (IPR031808):

  This is the N-terminal domain of WHAMM (WASP homologue-associated protein with actin, membranes and microtubules) and JMY (junction-mediating and -regulatory protein), two nucleation-promoting factors (NPFs) with similar domain architecture [ (PUBMED:26096974) ]. The function of this conserved region is not known; there are two highly conserved tryptophan residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WHAMM-JMY_N