SMART: Pfam domain WWE

The domain within your query sequence starts at position 40 and ends at position 112; the E-value for the WWE domain shown below is 7.5e-9.

VSPHWFYCKVLDSKELWIPFNSEDSQQLEDAYGSGKDCNERIVPTDGGRYDVHLGERMRY
AVYWDELPSEVRR

WWE

PFAM accession number:	PF02825
Interpro abstract (IPR004170):	The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor [ (PUBMED:16271883) ]. It is also found as an interaction module in protein ubiquination and ADP ribosylation proteins [ (PUBMED:11343911) ].

PFAM accession number:

PF02825

Interpro abstract (IPR004170):

The WWE domain is named after three of its conserved residues and is predicted to mediate specific protein-protein interactions in ubiquitin and ADP ribose conjugation systems. This domain is found as a tandem repeat at the N-terminal of Deltex, a cytosolic effector of Notch signalling thought to bind the N-terminal of the Notch receptor [ (PUBMED:16271883) ]. It is also found as an interaction module in protein ubiquination and ADP ribosylation proteins [ (PUBMED:11343911) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry WWE