The domain within your query sequence starts at position 607 and ends at position 787; the E-value for the Xylo_C domain shown below is 2.6e-73.
DSYLYGNYPAGTPGLRSYWENVYDEPDGIHTLSDVALTLYHSFIRLGLRRAESSLHTDGE NSCRYYPMGHPASVHLYFLADRFQGFLIKHHVTNLAVSKLETLETWMMPKKVFKVASPPS DFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNVIA A
Xylo_C |
---|
PFAM accession number: | PF12529 |
---|---|
Interpro abstract (IPR024448): | This domain is found in metazoan xylosyltransferases, which include xylosyltransferase 1 and xylosyltransferase 2. These enzymes initiate the biosynthesis of glycosaminoglycan chains in proteoglycans by transferring xylose from UDP-xylose to specific serine residues of the core protein [ (PUBMED:11099377) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Xylo_C