The domain within your query sequence starts at position 232 and ends at position 314; the E-value for the YEATS domain shown below is 2.1e-28.
THKWMVYVRGSRREPSINHFVKKVWFFLHPSYKPNDLVEVREPPFHLTRRGWGEFPVRVQ VHFKDSQNKRIDIIHNLKLDRTY
YEATS |
![]() |
---|
PFAM accession number: | PF03366 |
---|---|
Interpro abstract (IPR005033): | Named the YEATS family, after `YNK7', `ENL', `AF-9', and `TFIIF small subunit', this family also contains the GAS41 protein. All these proteins are thought to have a transcription stimulatory activity. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry YEATS