The domain within your query sequence starts at position 355 and ends at position 496; the E-value for the YTH domain shown below is 4.6e-44.
DARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFA RLSSESHHGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKI GRDGQEIELECGTQLCLLFPPD
YTH |
---|
PFAM accession number: | PF04146 |
---|---|
Interpro abstract (IPR007275): | The YTH (YT521-B homology) domain has been suggested to be an evolutionarily conserved m6A-dependent RNA binding domain [ (PUBMED:26318451) ]. Proteins containing this domain includes mammalian YTHD and YTDC proteins, Arabidopsis CPSF30 (At1g30460), budding yeast Pho92 and fission yeast Mmi1. In Saccharomyces cerevisiae, Pho92 is a posttranscriptional regulator that regulates Pho4 mRNA stability by binding to the 3'-UTR in a phosphate-dependent manner. Its YTH domain exhibits RNA-binding activity [ (PUBMED:24206186) ]. In Schizosaccharomyces pombe, Mmi1 has been identified as eliminating meiosis-specific mRNAs [ (PUBMED:16823445) ]. Rat YTHDC1 (also known as YT521-B) is an alternative splicing regulator that recognizes and binds N6-methyladenosine (m6A)-containing RNAs. The YTH domain of YT521-B is a RNA-binding domain with a very degenerate sequence-specificity [ (PUBMED:25389274) ]. |
GO function: | RNA binding (GO:0003723) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry YTH