The domain within your query sequence starts at position 36 and ends at position 74; the E-value for the Yae1_N domain shown below is 2.6e-14.
GYQEGYEEGSSLGIVEGKRYGMVHGAKIGSEIGCYRGFA
Yae1_N |
---|
PFAM accession number: | PF09811 |
---|---|
Interpro abstract (IPR019191): | This entry represents proteins found in the N-terminal region of the essential protein Yae1. Proteins containing this domain include ORAOV1 (Oral cancer-overexpressed protein 1) and YAE1 [ (PUBMED:23318452) ]. Their function is not clear. In Saccharomyces cerevisiae, Lto1 (ORAOV1 homologue) forms a complex with Rli1 and Yae1, which relieves the toxic effects of reactive oxygen species (ROS) on biogenesis and function of the ribosome [ (PUBMED:23318452) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Yae1_N