The domain within your query sequence starts at position 2 and ends at position 136; the E-value for the Zeta_toxin domain shown below is 2.3e-9.

EEKASKRAASIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRRE
AVSYRNYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLIL
QFAKEHGYKVFFIES

Zeta_toxin

 Zeta_toxin
PFAM accession number:PF06414
Interpro abstract (IPR010488):

This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [ (PUBMED:12571357) ]. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [ (PUBMED:12220496) (PUBMED:21445328) ].

GO function:kinase activity (GO:0016301), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zeta_toxin