The domain within your query sequence starts at position 67 and ends at position 388; the E-value for the Zfx_Zfy_act domain shown below is 2.6e-149.

ENVLIEDVHCSHILEETDISDNVIIPEQVLDLDTAEEVSLAQFLIPDILTSSITSTSLTM
PEHVLMSEAIHVSNVGHFEQVIHDSLVEREIITDPLTADISDILVADWASEAVLDSSGMP
LEQQDDARINCEDYLMMSLDEPSKTDHEGSSEVTMNAESETDSSKLDEASPEVIKVCILK
ADSEVDDVGETIQAVESETDNGNEAEVTDQRTSIHVPRVNIYMLASDSQKEEEDTKVIVG
DEDAGGTAADTPEHEQQMDVSEIKAAFLPIAWTAAYDNNSDEIEVQNATASAMLHHDESG
GLDRVPKQKSKKKKRPESKQYQ

Zfx_Zfy_act

Zfx_Zfy_act
PFAM accession number:PF04704
Interpro abstract (IPR006794):

Zfx and Zfy are transcription factors implicated in mammalian sex determination. This region is found N-terminal to multiple copies of a C2H2 Zinc finger. This region has been shown to activate transcription when fused to a GAL4 DNA binding domain [ (PUBMED:2105457) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)
GO function:DNA binding (GO:0003677), metal ion binding (GO:0046872)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Zfx_Zfy_act