The domain within your query sequence starts at position 1 and ends at position 149; the E-value for the bcl-2I13 domain shown below is 1.5e-72.
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGD EMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAW VSPDQDPGQLFPMVLLVFLLLGGAWYLQL
bcl-2I13 |
---|
PFAM accession number: | PF12201 |
---|---|
Interpro abstract (IPR024579): | Bcl-2-interacting killer promotes cell death in a manner similar to the death-promoting members of the Bcl-2 family, Bax and Bak. Its death-promoting activity can be suppressed by coexpression of Bcl-2, Bcl-XL, EBV-BHRF1 and E1B-19kDa proteins, suggesting that it may be a common target for both cellular and viral anti-apoptotic proteins [ (PUBMED:7478623) ]. |
GO process: | apoptotic process (GO:0006915) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry bcl-2I13