SMART: Pfam domain cobW

The domain within your query sequence starts at position 74 and ends at position 161; the E-value for the cobW domain shown below is 1.3e-4.

VTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIGQIACQKLVVVLNK
IDLLAEGKRQAAIDKMTKKMQKTLENTK

cobW

PFAM accession number:	PF02492
Interpro abstract (IPR003495):	This domain is found in HypB, a hydrogenase expression/formation protein, and urease accessory protein UreG. Both these proteins contain a P-loop nucleotide binding motif [ (PUBMED:9209019) (PUBMED:8423137) ]. HypB has GTPase activity and is a guanine nucleotide binding protein [ (PUBMED:8423137) ]. UreG is a GTPase in charge of nucleotide hydrolysis required for activation of the urease enzyme [ (PUBMED:25846143) ]. Both GTPases are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression [ (PUBMED:9140970) ]. UreG is required for functional incorporation of the urease nickel metallocentre [ (PUBMED:1624427) ]. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins [ (PUBMED:9140970) ]. Other proteins containing this domain include P47K ( P31521 ), a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, CobW ( P29937 ), which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans [ (PUBMED:1655697) ], and YjiA [ (PUBMED:14696199) ]. Both CobW and YjiA are members of the metal homeostasis-associated COG0523 family of GTPases [ (PUBMED:24449932) ].

PFAM accession number:

PF02492

Interpro abstract (IPR003495):

This domain is found in HypB, a hydrogenase expression/formation protein, and urease accessory protein UreG. Both these proteins contain a P-loop nucleotide binding motif [ (PUBMED:9209019) (PUBMED:8423137) ]. HypB has GTPase activity and is a guanine nucleotide binding protein [ (PUBMED:8423137) ]. UreG is a GTPase in charge of nucleotide hydrolysis required for activation of the urease enzyme [ (PUBMED:25846143) ]. Both GTPases are involved in nickel binding. HypB can store nickel and is required for nickel dependent hydrogenase expression [ (PUBMED:9140970) ]. UreG is required for functional incorporation of the urease nickel metallocentre [ (PUBMED:1624427) ]. GTP hydrolysis may required by these proteins for nickel incorporation into other nickel proteins [ (PUBMED:9140970) ].

Other proteins containing this domain include P47K ( P31521 ), a Pseudomonas chlororaphis protein needed for nitrile hydratase expression, CobW ( P29937 ), which may be involved in cobalamin biosynthesis in Pseudomonas denitrificans [ (PUBMED:1655697) ], and YjiA [ (PUBMED:14696199) ]. Both CobW and YjiA are members of the metal homeostasis-associated COG0523 family of GTPases [ (PUBMED:24449932) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry cobW