SMART: Pfam domain cwf21

The domain within your query sequence starts at position 58 and ends at position 102; the E-value for the cwf21 domain shown below is 1.5e-13.

LDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLEKD

cwf21

PFAM accession number:	PF08312
Interpro abstract (IPR013170):	The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ (PUBMED:11884590) ]. In yeast, this domain binds the protein Prp8p [ (PUBMED:19854871) ], a large and highly conserved U5 snRNP protein which has been proposed as a protein cofactor at the spliceosomal catalytic centre [ (PUBMED:11017191) ]. The cwf21 domain is found in, amongst others, the small Cwc21p protein in yeast as well as in the much larger human ortholog SRm300 (serine/arginine repetitive matrix protein).

PFAM accession number:

PF08312

Interpro abstract (IPR013170):

The cwf21 domain is found in proteins involved in mRNA splicing. Proteins containing this domain have been isolated as a subcomplex of the splicosome in Schizosaccharomyces pombe (Fission yeast) [ (PUBMED:11884590) ]. In yeast, this domain binds the protein Prp8p [ (PUBMED:19854871) ], a large and highly conserved U5 snRNP protein which has been proposed as a protein cofactor at the spliceosomal catalytic centre [ (PUBMED:11017191) ].

The cwf21 domain is found in, amongst others, the small Cwc21p protein in yeast as well as in the much larger human ortholog SRm300 (serine/arginine repetitive matrix protein).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry cwf21