The domain within your query sequence starts at position 2 and ends at position 92; the E-value for the dCMP_cyt_deam_2 domain shown below is 3.3e-12.
AQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACYP LGVCAERTAIQKAISEGYKDFRAIAISSDLQ
dCMP_cyt_deam_2 |
![]() |
---|
PFAM accession number: | PF08211 |
---|---|
Interpro abstract (IPR013171): | This region contains the zinc-binding domain of cytidine and deoxycytidylate deaminase. Cytidine deaminase ( EC 3.5.4.5 ) (cytidine aminohydrolase) catalyzes the hydrolysis of cytidine into uridine and ammonia while deoxycytidylate deaminase ( EC 3.5.4.12 ) (dCMP deaminase) hydrolyzes dCMP into dUMP. Both enzymes are known to bind zinc and to require it for their catalytic activity [ (PUBMED:1567863) (PUBMED:8428902) ]. These two enzymes do not share any sequence similarity with the exception of a region that contains three conserved histidine and cysteine residues which are thought to be involved in the binding of the catalytic zinc ion. |
GO process: | cytidine deamination (GO:0009972) |
GO function: | zinc ion binding (GO:0008270), cytidine deaminase activity (GO:0004126) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry dCMP_cyt_deam_2