SMART: Pfam domain dsDNA

The domain within your query sequence starts at position 91 and ends at position 192; the E-value for the dsDNA_bind domain shown below is 1.9e-34.

RAGVEPRTPEMDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVE
NYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNR

dsDNA_bind

PFAM accession number:	PF01984
Interpro abstract (IPR002836):	This protein family is found in archaea and eukaryota. Proteins in this family contain a predicted DNA-binding domain [ (PUBMED:11017201) ] and may function as DNA-binding proteins. Methanobacterium thermoautotrophicum MTH1615 was predicted to bind DNA based on structural proteomics data, and this was confirmed by the demonstration that it can interact non-specifically with a randomly chosen 20-mer of double stranded DNA [ (PUBMED:11017201) ]. This suggests that the human protein may be involved in nucleic acid binding or metabolism. The human programmed cell death protein 5 (PDCD5, also known as TFAR19) encodes a protein which shares significant homology to the corresponding proteins of species ranging from yeast to mice. PDCD5 exhibits a ubiquitous expression pattern and its expression is up-regulated in the tumour cells undergoing apoptosis. PDCD5 may play a general role in the apoptotic process [ (PUBMED:9920759) (PUBMED:19358820) ].
GO function:	DNA binding (GO:0003677)

PFAM accession number:

PF01984

Interpro abstract (IPR002836):

This protein family is found in archaea and eukaryota. Proteins in this family contain a predicted DNA-binding domain [ (PUBMED:11017201) ] and may function as DNA-binding proteins. Methanobacterium thermoautotrophicum MTH1615 was predicted to bind DNA based on structural proteomics data, and this was confirmed by the demonstration that it can interact non-specifically with a randomly chosen 20-mer of double stranded DNA [ (PUBMED:11017201) ]. This suggests that the human protein may be involved in nucleic acid binding or metabolism.

The human programmed cell death protein 5 (PDCD5, also known as TFAR19) encodes a protein which shares significant homology to the corresponding proteins of species ranging from yeast to mice. PDCD5 exhibits a ubiquitous expression pattern and its expression is up-regulated in the tumour cells undergoing apoptosis. PDCD5 may play a general role in the apoptotic process [ (PUBMED:9920759) (PUBMED:19358820) ].

GO function:

DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry dsDNA_bind