The domain within your query sequence starts at position 91 and ends at position 192; the E-value for the dsDNA_bind domain shown below is 1.9e-34.
RAGVEPRTPEMDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVE NYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNR
dsDNA_bind |
---|
PFAM accession number: | PF01984 |
---|---|
Interpro abstract (IPR002836): | This protein family is found in archaea and eukaryota. Proteins in this family contain a predicted DNA-binding domain [ (PUBMED:11017201) ] and may function as DNA-binding proteins. Methanobacterium thermoautotrophicum MTH1615 was predicted to bind DNA based on structural proteomics data, and this was confirmed by the demonstration that it can interact non-specifically with a randomly chosen 20-mer of double stranded DNA [ (PUBMED:11017201) ]. This suggests that the human protein may be involved in nucleic acid binding or metabolism. The human programmed cell death protein 5 (PDCD5, also known as TFAR19) encodes a protein which shares significant homology to the corresponding proteins of species ranging from yeast to mice. PDCD5 exhibits a ubiquitous expression pattern and its expression is up-regulated in the tumour cells undergoing apoptosis. PDCD5 may play a general role in the apoptotic process [ (PUBMED:9920759) (PUBMED:19358820) ]. |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry dsDNA_bind