SMART: Pfam domain hGDE

The domain within your query sequence starts at position 697 and ends at position 975; the E-value for the hGDE_central domain shown below is 5.6e-95.

GIIAARCAINRLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKT
SFYSKEVPQMCIPGKIEEVVLEARTIERNTKPYKKDENSINGMPNMTVELREHIQLHESK
IVRQAGVATKGPNEYIQEIEFENLSPGSVIIFRVSLDPHAQVAVGILRNHLTQFSSHFKS
GSLAVDNADPILKIPFASIASKLTLAELNQVLYRCESEEQEDGGGCYDIPNWSSLKYAGL
QGLMSVLAEIRPKNDLGHPFCENLRSGDWMIDYVSGRLI

hGDE_central

PFAM accession number:	PF14702
Interpro abstract (IPR032788):	This entry represents the central domain of the glycogen debranching enzyme AGL. AGL is a multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation [ (PUBMED:21585652) ]. This central domain follows the glucanotransferase domain and precedes the glucosidase domain. By analogy with baterial GDEs (glycogen debranching enzymes), this domain may be involved in substrate binding either for the N-terminal glucanotransferase and/or the C-terminal glucosidase (or both).

PFAM accession number:

PF14702

Interpro abstract (IPR032788):

This entry represents the central domain of the glycogen debranching enzyme AGL. AGL is a multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation [ (PUBMED:21585652) ]. This central domain follows the glucanotransferase domain and precedes the glucosidase domain. By analogy with baterial GDEs (glycogen debranching enzymes), this domain may be involved in substrate binding either for the N-terminal glucanotransferase and/or the C-terminal glucosidase (or both).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry hGDE_central