The domain within your query sequence starts at position 53 and ends at position 106; the E-value for the hSac2 domain shown below is 6.5e-9.
RVKEYFVFRPGTIEQAVEEIRAVVRPVEDGEIQGVWLLTEREGFGVRIQWDKQS
hSac2 |
![]() |
---|
PFAM accession number: | PF12456 |
---|---|
Interpro abstract (IPR022158): | This domain is found in eukaryotes, and is approximately 120 amino acids in length. It is often found in association with . It is found in hSac2, which functions as an inositol polyphosphate 5-phosphatase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry hSac2