The domain within your query sequence starts at position 133 and ends at position 218; the E-value for the ig domain shown below is 3.6e-8.
SSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRV DRSDDGVAVICRVDHESLNATPQVAM
ig |
 |
|---|
| PFAM accession number: | PF00047 |
|---|---|
| Interpro abstract (IPR013151): | This entry represents the immunoglobulin domain that is found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. This domain does not include the first and last strand of the immunoglobulin-like domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ig