The domain within your query sequence starts at position 464 and ends at position 559; the E-value for the mRNA_cap_C domain shown below is 1.9e-22.
LNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNS WVFMRQRIDKSFPNAYNTAMAVCNSISNPVTKEMLF
mRNA_cap_C |
![]() |
---|
PFAM accession number: | PF03919 |
---|---|
Interpro abstract (IPR013846): | This domain is found at the C terminus of the mRNA capping enzyme. The mRNA capping enzyme in yeasts is composed of two separate chains: alpha a mRNA guanyltransferase and beta an RNA 5'-triphosphate. X-ray crystallography reveals a large conformational change during guanyl transfer by mRNA capping enzymes [ (PUBMED:9160746) ]. Binding of the enzyme to nucleotides is specific to the GMP moiety of GTP. The viral mRNA capping enzyme is a monomer that transfers a GMP cap onto the end of mRNA that terminates with a 5'-diphosphate tail. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry mRNA_cap_C