The domain within your query sequence starts at position 8 and ends at position 43; the E-value for the mit_SMPDase domain shown below is 2.1e-17.
QPSFLLASLKADSINKPFAQRCQDLVKVIEDFPAKV
mit_SMPDase |
---|
PFAM accession number: | PF14724 |
---|---|
Interpro abstract (IPR024129): | Sphingomyelin phosphodiesterase 4 (also known as neutral sphingomyelinase 3) catalyses the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide [ (PUBMED:16517606) ]. |
GO function: | sphingomyelin phosphodiesterase D activity (GO:0050290) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry mit_SMPDase