The domain within your query sequence starts at position 8 and ends at position 43; the E-value for the mit_SMPDase domain shown below is 2.6e-17.

QPSFLLASLKADSINKPFAQRCQDLVKVIEDFPAKG

mit_SMPDase

mit_SMPDase
PFAM accession number:PF14724
Interpro abstract (IPR024129):

Sphingomyelin phosphodiesterase 4 (also known as neutral sphingomyelinase 3) catalyses the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide [ (PUBMED:16517606) ].

GO function:sphingomyelin phosphodiesterase D activity (GO:0050290)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry mit_SMPDase