The domain within your query sequence starts at position 307 and ends at position 574; the E-value for the muHD domain shown below is 3.9e-75.
LPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSS RLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVS AQGIQSTPLNLAVNWRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAV LPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLS GCDIELVGAGYRFSLIKKRFAAGKYLAD
muHD |
---|
PFAM accession number: | PF10291 |
---|---|
Interpro abstract (IPR018808): | The muniscins are a family of endocytic adaptors that is conserved from yeast to humans.This C-terminal domain is structurally similar to mu homology domains, and is the region of the muniscin proteins involved in the interactions with the endocytic adaptor-scaffold proteins Ede1-eps15. This interaction influences muniscin localisation. The muniscins provide a combined adaptor-membrane-tubulation activity that is important for regulating endocytosis [ (PUBMED:19713939) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry muHD