SMART: Pfam domain muHD

The domain within your query sequence starts at position 391 and ends at position 658; the E-value for the muHD domain shown below is 5.9e-79.

LPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSS
RLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVS
AQGIQSTPLNLAVNWRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAV
LPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLS
GCDIELVGAGYRFSLIKKRFAAGKYLAD

muHD

PFAM accession number:	PF10291
Interpro abstract (IPR018808):	The muniscins are a family of endocytic adaptors that is conserved from yeast to humans.This C-terminal domain is structurally similar to mu homology domains, and is the region of the muniscin proteins involved in the interactions with the endocytic adaptor-scaffold proteins Ede1-eps15. This interaction influences muniscin localisation. The muniscins provide a combined adaptor-membrane-tubulation activity that is important for regulating endocytosis [ (PUBMED:19713939) ].

PFAM accession number:

PF10291

Interpro abstract (IPR018808):

The muniscins are a family of endocytic adaptors that is conserved from yeast to humans.This C-terminal domain is structurally similar to mu homology domains, and is the region of the muniscin proteins involved in the interactions with the endocytic adaptor-scaffold proteins Ede1-eps15. This interaction influences muniscin localisation. The muniscins provide a combined adaptor-membrane-tubulation activity that is important for regulating endocytosis [ (PUBMED:19713939) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry muHD