SMART: Pfam domain nlz1

The domain within your query sequence starts at position 361 and ends at position 421; the E-value for the nlz1 domain shown below is 7.7e-32.

AGMTYPGSLAGAYAGYPPQFLPHGVALDPTKPGSLVGAQLAAAAAGSLGCSKPAGSSPLA
G

nlz1

PFAM accession number:	PF12402
Interpro abstract (IPR022129):	This domain family is found in eukaryotes, and is typically between 42 and 57 amino acids in length. There is a conserved GAY sequence motif. There is a single completely conserved residue G that may be functionally important. Nlz1 self-associated via its C terminus, interacted with Nlz2, and bound to histone deacetylases. These proteins may function as a transcriptional repressors [ (PUBMED:14550789) ].

PFAM accession number:

PF12402

Interpro abstract (IPR022129):

This domain family is found in eukaryotes, and is typically between 42 and 57 amino acids in length. There is a conserved GAY sequence motif. There is a single completely conserved residue G that may be functionally important. Nlz1 self-associated via its C terminus, interacted with Nlz2, and bound to histone deacetylases. These proteins may function as a transcriptional repressors [ (PUBMED:14550789) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry nlz1