The domain within your query sequence starts at position 13 and ends at position 276; the E-value for the p31comet domain shown below is 6.4e-166.

SPAAAPNLDWYEKPEETHAPEVDLETVIPPAQEPSNPAEPFCPRDLVPVVFPGPVSQEDC
CQFTCELLKHILYQRHQLPLPYEQLKHFYRKVPQAEDTARKKAWLATEARNRKCQQALAE
LESVLSHLRDFFARTLVPQVLILLGGNALSPKEFYELDLSRLAPFGVDQGLNTAACLRRL
FRAIFLADPFSELQTPPLMGTIVMVQGHRDCGEDWFQPKLNYRVPSRGHKLTVTLSCGRP
SVPAMASEDYIWFQAPVTLKGFHE

p31comet

p31comet
PFAM accession number:PF06581
Interpro abstract (IPR009511):

This entry represents Mad1 and Cdc20-bound-Mad2 binding proteins that are involved in the cell-cycle surveillance mechanism called the spindle checkpoint [ (PUBMED:12456649) ]. This mechanism monitors the proper bipolar attachment of sister chromatids to spindle microtubules and ensures the fidelity of chromosome segregation during mitosis. A key player in mitosis is Mad2, which exhibits an unusual two-state behaviour. A Mad1-Mad2 core complex recruits cytosolic Mad2 to kinetochores through Mad2 dimerisation and converts Mad2 to a conformer amenable to Cdc20 binding. p31comet inactivates the checkpoint by binding to Mad1- or Cdc20-bound Mad2 in such a way as to stop Mad2 activation and to promote the dissociation of the Mad2-Cdc20 complex [ (PUBMED:18022368) ].

GO process:regulation of exit from mitosis (GO:0007096)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry p31comet