The domain within your query sequence starts at position 13 and ends at position 276; the E-value for the p31comet domain shown below is 6.4e-166.
SPAAAPNLDWYEKPEETHAPEVDLETVIPPAQEPSNPAEPFCPRDLVPVVFPGPVSQEDC CQFTCELLKHILYQRHQLPLPYEQLKHFYRKVPQAEDTARKKAWLATEARNRKCQQALAE LESVLSHLRDFFARTLVPQVLILLGGNALSPKEFYELDLSRLAPFGVDQGLNTAACLRRL FRAIFLADPFSELQTPPLMGTIVMVQGHRDCGEDWFQPKLNYRVPSRGHKLTVTLSCGRP SVPAMASEDYIWFQAPVTLKGFHE
p31comet |
---|
PFAM accession number: | PF06581 |
---|---|
Interpro abstract (IPR009511): | This entry represents Mad1 and Cdc20-bound-Mad2 binding proteins that are involved in the cell-cycle surveillance mechanism called the spindle checkpoint [ (PUBMED:12456649) ]. This mechanism monitors the proper bipolar attachment of sister chromatids to spindle microtubules and ensures the fidelity of chromosome segregation during mitosis. A key player in mitosis is Mad2, which exhibits an unusual two-state behaviour. A Mad1-Mad2 core complex recruits cytosolic Mad2 to kinetochores through Mad2 dimerisation and converts Mad2 to a conformer amenable to Cdc20 binding. p31comet inactivates the checkpoint by binding to Mad1- or Cdc20-bound Mad2 in such a way as to stop Mad2 activation and to promote the dissociation of the Mad2-Cdc20 complex [ (PUBMED:18022368) ]. |
GO process: | regulation of exit from mitosis (GO:0007096) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry p31comet