The domain within your query sequence starts at position 555 and ends at position 623; the E-value for the tRNA-synt_1_2 domain shown below is 1.9e-11.
YQHLKGKCVVHPFLSRSLPIVFDDFVDMEFGTGAVKITPAHDQNDYEVGQRHRLEAISIM DSKGALINV
tRNA-synt_1_2 |
![]() |
---|
PFAM accession number: | PF13603 |
---|---|
Interpro abstract (IPR025709): | This entry represents the editing domain (known as CP1 domain) of Leucyl-tRNA synthetase ( EC 6.1.1.4 ), which hydrolyses mischarged tRNALeu. In the case of Leucyl-tRNA synthetase, the beta-strands that link the CP1 domain to the aminoacylation core of the protein are also required for editing activity [ (PUBMED:17474713) ]. |
GO process: | tRNA aminoacylation for protein translation (GO:0006418) |
GO function: | aminoacyl-tRNA editing activity (GO:0002161) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA-synt_1_2