The domain within your query sequence starts at position 63 and ends at position 130; the E-value for the tRNA_int_end_N2 domain shown below is 1.4e-21.

WQLLAEERVERLGSLVAAEWKPEEGFVELTSPAGKFWQTMGYSEEGRQRLHPEEALYLLE
CGSIQLFY

tRNA_int_end_N2

• PFAM accession number: PF12928
• Interpro abstract (IPR024336):

  tRNA-splicing endonucleases ( EC 3.1.27.9 ) catalyse the endonucleolytic cleavage of pre tRNA at the 5' and 3' splice sites to release the intron and produces two half tRNA molecules bearing 5' hydroxyl and 2', 3'-cyclic phosphate termini [ (PUBMED:9321408) (PUBMED:9200603) ]. The genes encoding these proteins are homologous in eukaryotes and archea. The eukaryotic tRNA-splicing endonucleases are heterotetrameric while the archaeal endonucleases can be split into homodimeric and homotetrameric subgroups.

  This entry represents the N-terminal domain of Sen54, a non-catalytic subunit of the tRNA-splicing endonuclease complex. Defects in human Sen54 are a cause of pontocerebellar hypoplasia type 4 [ (PUBMED:18711368) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry tRNA_int_end_N2