The domain within your query sequence starts at position 9 and ends at position 54; the E-value for the zf-C6H2 domain shown below is 1.6e-23.
CETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKK
zf-C6H2 |
---|
PFAM accession number: | PF15801 |
---|---|
Interpro abstract (IPR031615): | This entry represents an unusual zinc-finger similar to Zfn-MYND, IPR002893 . This zinc-finger is found in the N-terminal of methionine aminopeptidase 1, but it is missing in prokaryotic methionine aminopeptidases. It consists of a C2-C2 zinc-finger motif similar to the RING finger family followed by a C2H2 motif similar to zinc-fingers involved in RNA-binding. In yeast the domain chelates zinc in a 2:1 ratio. The domain is found in yeast, plants and mammals. The domain is necessary for the association of the methionine aminopeptidase with the ribosome and the normal processing of the peptidase [ (PUBMED:11968008) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-C6H2