The domain within your query sequence starts at position 4 and ends at position 78; the E-value for the zf-NOSIP domain shown below is 1.2e-55.
HGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGY LYEREAILEYILHQK
zf-NOSIP |
---|
PFAM accession number: | PF15906 |
---|---|
Interpro abstract (IPR031790): | This entry represents a zinc-finger in nitric oxide synthase-interacting protein (NOSIP) [ (PUBMED:11149895) ]. NOSIP may modulate nitric oxide homeostasis in physiological and pathological pain conditions [ (PUBMED:12962906) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-NOSIP