The domain within your query sequence starts at position 728 and ends at position 816; the E-value for the zf-TFIIIC domain shown below is 2.7e-13.
HISKKMNKQTFPERCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHD SIARHPVPEDPDWIKRLLQSPCPFCDSPV
zf-TFIIIC |
 |
|---|
| PFAM accession number: | PF12660 |
|---|---|
| Interpro abstract (IPR024764): | This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [ (PUBMED:10523658) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-TFIIIC