The domain within your query sequence starts at position 2 and ends at position 67; the E-value for the zf-Tim10_DDP domain shown below is 8.1e-19.
EQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLM AAYVHL
zf-Tim10_DDP |
![]() |
---|
PFAM accession number: | PF02953 |
---|---|
Interpro abstract (IPR004217): | This domain has four conserved cysteine residues. It is found in proteins Tim8, Tim9, Tim10 and Tim13, which are involved in mitochondrial protein import [ (PUBMED:11101512) ] and seem to be localised to the mitochondrial intermembrane space. The Tim8-Tim13 complex has a complex architecture, similar to the Tim9-Tim10 complex, composed of a hexametric architecture with long helices which look like tentacles extend from a central loop [ (PUBMED:18706423) ]. In each subunit of the Tim9-Tim10 complex, a signature "twin CX3C" motif forms two intramolecular disulfides [ (PUBMED:16387659) ]. Defects in the Tim8A gene (DDP1) have been shown to be the cause of 2 human syndromes: Mohr-Tranebjaerg syndrome (MTS); also known as dystonia-deafness syndrome (DDS) or X-linked progressive deafness type 1 (DFN-1); and Jensen syndrome (JENSS); also known as opticoacoustic nerve atrophy with dementia. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-Tim10_DDP