The domain within your query sequence starts at position 57 and ends at position 110; the E-value for the zf-nanos domain shown below is 1.2e-28.
CSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPL
zf-nanos |
![]() |
---|
PFAM accession number: | PF05741 |
---|---|
Interpro abstract (IPR024161): | Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3'untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy-terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [ (PUBMED:8223259) (PUBMED:10518502) (PUBMED:20948543) ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix [ (PUBMED:20948543) ]. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry zf-nanos