The domain within your query sequence starts at position 191 and ends at position 249; the E-value for the zinc_ribbon_6 domain shown below is 6.6e-32.

LDMTRYWRQLDTEVAQTPMPSEYQNVTVDILCNDCNGRSTVQFHILGMKCKLCDSYNTA

zinc_ribbon_6

zinc_ribbon_6
PFAM accession number:PF14599
Interpro abstract (IPR039512):

This entry represents the zinc-ribbon domain found in RCHY1 and related proteins. RCHY1, also known as Pirh2, is a ubiquitin E3 ligase that mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, P73, HDAC1 and CDKN1B [ (PUBMED:21994467) (PUBMED:28191284) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry zinc_ribbon_6